Chlorophycean mitochondrial code

Category:Articles with short descriptionCategory:Short description is different from Wikidata

The chlorophycean mitochondrial code (translation table 16) is a genetic code found in the mitochondria of Chlorophyceae.

Code

   AAs = FFLLSSSSYY*LCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = -----------------------------------M----------------------------
 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code

DNA codonsRNA codonsThis code (16)Standard code (1)
TAGUAGLeu (L)STOP = Ter (*)

Systematic range and comments

Chlorophyceae[1] and the chytridiomycete fungus Spizellomyces punctatus.[2]

See also

References

This article incorporates text from the United States National Library of Medicine, which is in the public domain. Category:Wikipedia articles incorporating text from the United States National Library of Medicine [3]

  1. ↑ Y Hayashi-Ishimaru; T Ohama; Y Kawatsu; K Nakamura; S Osawa (June 1996). "UAG is a sense codon in several chlorophycean mitochondria". Current Genetics. 30 (1): 29–33. doi:10.1007/s002940050096. PMID 8662206. S2CID 7175211.
  2. ↑ M. J. Laforest; I. Roewer; B. F. Lang (1 February 1997). "Mitochondrial tRNAs in the lower fungus Spizellomyces punctatus: tRNA editing and UAG 'stop' codons recognized as leucine". Nucleic Acids Research. 25 (3): 626–32. doi:10.1093/nar/25.3.626. PMC 146481. PMID 9016605.
  3. ↑ Elzanowski A, Ostell J, Leipe D, Soussov V. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. Retrieved 10 August 2016.

Category:Use dmy dates from August 2016

Category:Molecular genetics Category:Gene expression Category:Protein biosynthesis
Category:Articles with short description Category:Gene expression Category:Molecular genetics Category:Protein biosynthesis Category:Short description is different from Wikidata Category:Use dmy dates from August 2016 Category:Wikipedia articles incorporating text from the United States National Library of Medicine